DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and PLIM2a

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_182104.1 Gene:PLIM2a / 819188 AraportID:AT2G45800 Length:226 Species:Arabidopsis thaliana


Alignment Length:154 Identity:37/154 - (24%)
Similarity:59/154 - (38%) Gaps:46/154 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LDKHAARCSACRTPILERGVAAAE-RKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELF- 120
            |||    |.||...:....:...| ..:|:.||||..|..:||.:::..::|.|:||.||.:|| 
plant     7 LDK----CKACDKTVYVMDLLTLEGNTYHKSCFRCTHCKGTLVISNYSSMDGVLYCKPHFEQLFK 67

  Fly   121 -----------------------------------SSRCAGCEK---PIDRRAVVALSTKWHAKC 147
                                               ..:||.|:|   |:::  |......:|..|
plant    68 ESGNYSKNFQAGKTEKPNDHLTRTPSKLSSFFSGTQDKCATCKKTVYPLEK--VTMEGESYHKTC 130

  Fly   148 FKCHHCRKRISAREFWIENGQPIC 171
            |:|.|....::...:...||...|
plant   131 FRCTHSGCPLTHSSYASLNGVLYC 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 2/2 (100%)
LIM 65..116 CDD:259829 16/51 (31%)
LIM 124..171 CDD:295319 13/49 (27%)
PLIM2aNP_182104.1 LIM1_SF3 6..68 CDD:188824 23/64 (36%)
LIM 106..166 CDD:413332 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.