DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and AT2G28460

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_180413.2 Gene:AT2G28460 / 817394 AraportID:AT2G28460 Length:720 Species:Arabidopsis thaliana


Alignment Length:273 Identity:49/273 - (17%)
Similarity:77/273 - (28%) Gaps:109/273 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCRCNEKI---WPRAVCSLGKTYHPHHFTCKECGL----------------VVDPKLFFAVDDDV 51
            |..|.:||   :...||:.|.:|..|.....:..:                |:.|  |..:.|.:
plant   355 CSVCRKKIDNDYGGYVCTKGCSYAAHSKCATQSNVWDGIELEGEPEDIEEEVLPP--FLEISDGI 417

  Fly    52 VCSECY------LDKHAAR-------CSACRTP--------------ILERGVAAAERKWH---- 85
            :....:      ||::..|       |.||..|              ||....|...||.|    
plant   418 IQHFSHQQHHMKLDENTGRDYDENKECEACIRPIYFGNFYSCLECDFILHEECANLSRKIHHPIH 482

  Fly    86 ------------------EKCFRCVSCSKSLVSASFFEVNGYLFCK-----------------AH 115
                              :||..|:    .|....||...|...||                 :|
plant   483 PHLLNLIGGFDGVINYYNDKCSACI----GLCKGGFFYECGKQGCKFMLHVQCATTSEPLVHESH 543

  Fly   116 FRELFSS-------RCAGCEKPIDRRAVVALSTKWHAKCFKCHHCRKRISAR--------EFWIE 165
            ...||.:       ||:.|:...:....:...   .|.||.|....:::..:        .:..|
plant   544 RHPLFLTSKPGEKIRCSVCKDSEETFNCIECD---FALCFYCAILPQKVRYKHDKHTLTLSYGKE 605

  Fly   166 NGQPICAACQTVV 178
            .|...|..|:..:
plant   606 TGTSWCEVCEAKI 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 15/79 (19%)
LIM 65..116 CDD:259829 19/103 (18%)
LIM 124..171 CDD:295319 8/54 (15%)
AT2G28460NP_180413.2 C1_3 243..271 CDD:284959
C1_3 298..327 CDD:284959
C1_2 353..384 CDD:281148 9/28 (32%)
C1_3 442..471 CDD:284959 6/28 (21%)
C1_2 610..639 CDD:281148 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.