DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and LIMD2

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_085053.1 Gene:LIMD2 / 80774 HGNCID:28142 Length:127 Species:Homo sapiens


Alignment Length:61 Identity:21/61 - (34%)
Similarity:35/61 - (57%) Gaps:3/61 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CSACRTPI--LERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSR 123
            |:||:..:  :|| :.|.:..:|..||.|..|...|...|:..::|..:||.||::||.|:
Human    40 CAACQKTVYPMER-LVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319
LIM 65..116 CDD:259829 16/52 (31%)
LIM 124..171 CDD:295319 21/61 (34%)
LIMD2NP_085053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
LIM_Eplin_like_1 40..92 CDD:188870 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6650
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.