DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and ldb3a

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_021336348.1 Gene:ldb3a / 794339 ZFINID:ZDB-GENE-040121-6 Length:746 Species:Danio rerio


Alignment Length:169 Identity:50/169 - (29%)
Similarity:84/169 - (49%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSACR 69
            :|..||..|....:.:||:::||..|.|..|...:....|....::|.|..||.:..|..|:.|.
Zfish   569 LCATCNNIIRGPFLVALGRSWHPEEFNCHYCHTSLADVSFVEEQNNVYCENCYEEFFAPTCARCS 633

  Fly    70 TPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDR- 133
            |.|:...:.|..:.||..||.|.:|.|...::.|...:|..:|:..:..|||::|.||:.|::. 
Zfish   634 TKIMGEVMHALRQTWHTTCFVCAACGKPFGNSLFHMEDGEPYCEKDYIALFSTKCHGCDFPVEAG 698

  Fly   134 -RAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPIC 171
             :.:.||...||..||.|..|...:..:.|:.:..:|:|
Zfish   699 DKFIEALGHTWHDTCFVCAVCHVNLEGQPFYSKKDKPLC 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 16/54 (30%)
LIM 65..116 CDD:259829 15/50 (30%)
LIM 124..171 CDD:295319 14/48 (29%)
ldb3aXP_021336348.1 PDZ_signaling 13..82 CDD:238492
DUF4749 149..239 CDD:318205
LIM1_ZASP_Cypher 570..621 CDD:188838 14/50 (28%)
LIM2_Enigma_like 629..680 CDD:188748 15/50 (30%)
LIM3_ZASP_Cypher 688..742 CDD:188844 15/50 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.