DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Pdlim7

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001107560.1 Gene:Pdlim7 / 67399 MGIID:1914649 Length:457 Species:Mus musculus


Alignment Length:169 Identity:51/169 - (30%)
Similarity:88/169 - (52%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSACR 69
            :|.:|::.|..|.:.:||..|||..|.|.:||.|::...||.....:.|..||..::|..|:.|:
Mouse   281 VCHQCHKIIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPSCYDVRYAPNCAKCK 345

  Fly    70 TPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDR- 133
            ..|....:.|.:..||..||.|.:|...:.:.:|:...|..:|:..:.::|.::|.||:..||. 
Mouse   346 KKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFYMEEGAPYCERDYEKMFGTKCRGCDFKIDAG 410

  Fly   134 -RAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPIC 171
             |.:.||...||..||.|..|:..:..:.|:.:..:|:|
Mouse   411 DRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDKPLC 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 19/54 (35%)
LIM 65..116 CDD:259829 13/50 (26%)
LIM 124..171 CDD:295319 16/48 (33%)
Pdlim7NP_001107560.1 PDZ_signaling 5..79 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..166
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..226
LIM1_Enigma 282..333 CDD:188836 17/50 (34%)
LIM2_Enigma 341..392 CDD:188840 13/50 (26%)
LIM3_Enigma 400..454 CDD:188842 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.