DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Pdlim5

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_006233474.1 Gene:Pdlim5 / 64353 RGDID:621076 Length:624 Species:Rattus norvegicus


Alignment Length:176 Identity:53/176 - (30%)
Similarity:83/176 - (47%) Gaps:16/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWPRAVCSLGKTYHPHHFTCKEC-------GLVVDPKLFFAVDDDVVCSECYLDKHA 62
            :|..||:.|....:.:|||::||..|.|..|       |.|.:....:       |..||....|
  Rat   447 MCAHCNQAIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALY-------CELCYEKFFA 504

  Fly    63 ARCSACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGC 127
            ..|..|:..||...:.|.::.||..||.||:|.|.:.:..|...:|..:|:..:..||.:.|.||
  Rat   505 PECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICRGC 569

  Fly   128 EKPIDR--RAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPIC 171
            |.||:.  ..:.||.:.||..||.|..|.:.:..:.|:.:..:|:|
  Rat   570 EFPIEAGDMFLEALGSTWHDTCFVCSVCCESLEGQTFFSKKDKPLC 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 17/61 (28%)
LIM 65..116 CDD:259829 16/50 (32%)
LIM 124..171 CDD:295319 16/48 (33%)
Pdlim5XP_006233474.1 PDZ_signaling 10..82 CDD:238492
DUF4749 214..305 CDD:292558
LIM1_ENH 448..499 CDD:188837 15/57 (26%)
LIM 507..558 CDD:295319 16/50 (32%)
LIM 566..620 CDD:295319 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.