powered by:
Protein Alignment CG30178 and synpo2la
DIOPT Version :9
Sequence 1: | NP_726395.1 |
Gene: | CG30178 / 246501 |
FlyBaseID: | FBgn0050178 |
Length: | 187 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_009305650.2 |
Gene: | synpo2la / 563843 |
ZFINID: | ZDB-GENE-090828-4 |
Length: | 1179 |
Species: | Danio rerio |
Alignment Length: | 67 |
Identity: | 15/67 - (22%) |
Similarity: | 27/67 - (40%) |
Gaps: | 9/67 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 VDDDVVCSECYLDKHAARCSACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLF 111
||:::..: |:|| .:...|.||....:::..|...:|.:.:..|..|......|.|.
Zfish 306 VDEELTLT--YMDK-------AKQAKLNRGETITDKQVKEARSKCRTIASLLTDAPNPHSKGVLM 361
Fly 112 CK 113
.|
Zfish 362 FK 363
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1703 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.