DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and fhl3b

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001093448.1 Gene:fhl3b / 555053 ZFINID:ZDB-GENE-030131-8356 Length:290 Species:Danio rerio


Alignment Length:194 Identity:55/194 - (28%)
Similarity:79/194 - (40%) Gaps:22/194 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ASIC--CRCNEKIWPRAVCSLGKT--------------YHPHHFTCKECGLVVDPKLFFAVDDDV 51
            |.:|  |.|||.......|  |||              :|...|.|..|...:..:.|....|:.
Zfish    86 ALVCNNCYCNEFSSNCVAC--GKTVMPGSKRLEYEDCVWHEECFVCCGCEQPIGAQSFIPDKDEY 148

  Fly    52 VCSECYLDKHAARCSACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHF 116
            .|..||..:.|.||:.|:..:::.||...:..||::||.|..|...|....|.......:|...|
Zfish   149 YCVPCYEGRFAPRCAHCKQTLVQGGVTYRDEPWHKECFLCTGCKVQLAGQPFTTQGEDPYCVKCF 213

  Fly   117 RELFSSRCAGCEKPI----DRRAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPICAACQT 176
            ..|::.:||.|||||    :.:.|.....:||..||||..|...:....|:......:|..|.|
Zfish   214 SNLYAQKCAACEKPITGFGEGKYVSFEERQWHKPCFKCSVCSLSLVGAGFFPHGSMILCKGCNT 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 18/70 (26%)
LIM 65..116 CDD:259829 13/50 (26%)
LIM 124..171 CDD:295319 16/50 (32%)
fhl3bNP_001093448.1 LIM <5..33 CDD:295319
LIM1_FHL3 36..94 CDD:188807 3/7 (43%)
LIM2_FHL3 98..155 CDD:188811 12/58 (21%)
LIM3_FHL 162..213 CDD:188732 13/50 (26%)
LIM4_FHL3 221..276 CDD:188818 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11189
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4575
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.