DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and pdlim3a

DIOPT Version :10

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001019547.1 Gene:pdlim3a / 554148 ZFINID:ZDB-GENE-050505-1 Length:307 Species:Danio rerio


Alignment Length:51 Identity:13/51 - (25%)
Similarity:25/51 - (49%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CSACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAH 115
            |..|...|:...|...::..|..||.|..|.::|....::.::..|:|::|
Zfish   244 CDKCGNGIVGTVVKVQDKFRHPDCFVCTECEENLKQKGYYFIDDELYCESH 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:413332
LIM 65..116 CDD:259829 13/51 (25%)
LIM 124..171 CDD:413332
pdlim3aNP_001019547.1 PDZ_PDLIM-like 4..82 CDD:467235
DUF4749 134..214 CDD:464948
LIM_ALP_like 244..295 CDD:188746 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.