DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and pdlim5

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_012817118.2 Gene:pdlim5 / 548530 XenbaseID:XB-GENE-854114 Length:884 Species:Xenopus tropicalis


Alignment Length:169 Identity:51/169 - (30%)
Similarity:82/169 - (48%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSACR 69
            :|..||:.|....:.:|||::||..|.|..|...:....|......:.|..||....|..|:.|:
 Frog   707 MCAICNKVIRGPFLLALGKSWHPEEFNCAHCKSSMAEMGFVEEKGGLYCEICYEKLFAPECARCQ 771

  Fly    70 TPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDR- 133
            ..||...:.|.::.||..||.||:|...:.::.|...:|..:|:..:..||.:.|.|||.||:. 
 Frog   772 RKILGEVINALKQTWHVSCFVCVACQTPIRNSVFHLEDGEPYCETDYYSLFGTICHGCEFPIEAG 836

  Fly   134 -RAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPIC 171
             |.:.||...||..||.|..|.:.:..:.|:.:..:.:|
 Frog   837 DRFLEALGHTWHNTCFVCTICCENLEGQTFFSKKDKLLC 875

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 16/54 (30%)
LIM 65..116 CDD:259829 15/50 (30%)
LIM 124..171 CDD:295319 16/48 (33%)
pdlim5XP_012817118.2 PDZ 10..83 CDD:214570
PRK14951 <80..216 CDD:237865
DUF4749 212..320 CDD:406377
LIM1_ENH 708..759 CDD:188837 14/50 (28%)
LIM2_Enigma_like 767..818 CDD:188748 15/50 (30%)
LIM3_ENH 826..880 CDD:188843 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.