DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Synpo2

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001178892.1 Gene:Synpo2 / 499702 RGDID:1564779 Length:1262 Species:Rattus norvegicus


Alignment Length:58 Identity:16/58 - (27%)
Similarity:23/58 - (39%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KHAARCSACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFR 117
            ||.||.:.     |.|..:.:|::..|...:|.|.:..|..|......|.|..|...|
  Rat   344 KHRARHAR-----LRRSESLSEKQVKEAKSKCKSIALLLTDAPNPNSKGVLMFKKRRR 396

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity