DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Lims1

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_017457250.1 Gene:Lims1 / 499443 RGDID:1560732 Length:407 Species:Rattus norvegicus


Alignment Length:178 Identity:52/178 - (29%)
Similarity:84/178 - (47%) Gaps:6/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWPRAVCSLGKTYHPHHFTCKECG--LVVDPKLFFAVDDDVVCSECYLDKHAARCSA 67
            ||.:|:..|..:.:......|||.||.|..||  |..|.:   .:..::.|..|:.......|.|
  Rat   205 ICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADAR---ELKGELYCLPCHDKMGVPICGA 266

  Fly    68 CRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPID 132
            ||.||..|.|.|..::||.:.|.|..|.|..:....:|..|..:|:.|:.:||...|..|.:.|:
  Rat   267 CRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIE 331

  Fly   133 RRAVVALSTKWHAKCFKCHHCRKRISAREFWIE-NGQPICAACQTVVP 179
            ...|.||:..|...||.|..|..:::.::.::. :.:|:|..|...:|
  Rat   332 GDVVSALNKAWCVSCFACSTCNTKLTLKDKFVAIDLKPVCKYCYEKMP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 15/56 (27%)
LIM 65..116 CDD:259829 18/50 (36%)
LIM 124..171 CDD:295319 12/47 (26%)
Lims1XP_017457250.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.