DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and pk

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster


Alignment Length:204 Identity:57/204 - (27%)
Similarity:84/204 - (41%) Gaps:25/204 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSASICCRCNE------------KIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVC 53
            |||..|..|::            ::.|.|      ::||..|.|..|..::...::|..|..:.|
  Fly   619 MSARPCDGCDDLISTGDIAVFATRLGPNA------SWHPACFACSVCRELLVDLIYFHRDGRMYC 677

  Fly    54 SECYLDKHAARCSACRTPILERGVAAAE-RKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFR 117
            ...:.:....|||||...||......|| |.||...|.|..|.|.|....:....|..:|...|.
  Fly   678 GRHHAETLKPRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHCFD 742

  Fly   118 ELFSSRCAGCEKPI--DRRAVVALSTKWHA--KCFKCHHCRKRISAREFWIENGQPICA-AC-QT 176
            .:|:..|..|.:.|  |:..:......|||  :||.|:.||..:..|.|....|...|: || :.
  Fly   743 AMFAEYCDYCGEAIGVDQGQMSHDGQHWHATDECFSCNTCRCSLLGRAFLPRRGAIYCSIACSKG 807

  Fly   177 VVPSPRNLS 185
            ..|:|.:.|
  Fly   808 EPPTPSDSS 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 12/66 (18%)
LIM 65..116 CDD:259829 18/51 (35%)
LIM 124..171 CDD:295319 15/50 (30%)
pkNP_724538.1 PET_Prickle 523..618 CDD:193602
LIM1_Prickle 624..682 CDD:188799 12/63 (19%)
LIM2_Prickle 687..742 CDD:188802 19/54 (35%)
LIM3_Prickle 747..805 CDD:188804 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
32.920

Return to query results.
Submit another query.