DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and fhl1

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001006703.1 Gene:fhl1 / 448334 XenbaseID:XB-GENE-964257 Length:296 Species:Xenopus tropicalis


Alignment Length:176 Identity:54/176 - (30%)
Similarity:73/176 - (41%) Gaps:7/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCRCNEKIWP--RAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSAC 68
            |..|:::|.|  |.|...|..:|...|||..|...:....||....||.|..|:..|.|..|..|
 Frog   117 CSGCHKQIQPGGRNVEYKGSAWHEECFTCSNCKQAIGSGSFFPKGTDVYCVTCHEQKFAKNCVKC 181

  Fly    69 RTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPI-- 131
            ..||...|:...::.||..||.|.:|.|.|....|..|..:.:|...::...:.:||||..||  
 Frog   182 NNPITSGGITYQDQPWHGDCFVCETCHKKLAGQRFTAVEDHYYCVDCYKSFVAKKCAGCNNPITG 246

  Fly   132 ---DRRAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPICAAC 174
               ....|......||..||.|..|...::.:.|...|.|..|..|
 Frog   247 FGKGSNVVNYEGNSWHEYCFTCKKCSLNLANKRFVRHNEQVYCQDC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 18/56 (32%)
LIM 65..116 CDD:259829 16/50 (32%)
LIM 124..171 CDD:295319 16/51 (31%)
fhl1NP_001006703.1 LIM1_FHL1 56..109 CDD:188730
LIM2_FHL1 117..174 CDD:188808 18/56 (32%)
LIM3_FHL1 178..230 CDD:188813 16/51 (31%)
LIM4_FHL1 233..296 CDD:188734 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I4543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.