DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and fhl5

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001004112.1 Gene:fhl5 / 445475 ZFINID:ZDB-GENE-040822-3 Length:280 Species:Danio rerio


Alignment Length:185 Identity:51/185 - (27%)
Similarity:87/185 - (47%) Gaps:16/185 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCRCNEKIWPRA--VCSL------------GKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSEC 56
            |.:|.|.::...  ||||            .:.:|.:.|.|.:|...:..|.|.|.|:.::|:||
Zfish    29 CTKCYENLFANCCEVCSLPIGCNCKDLSYKDRHWHENCFKCAKCSRSLVDKPFAAKDELMLCTEC 93

  Fly    57 YLDKHAARCSACRTPIL--ERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFREL 119
            |..:::::||.|:..::  .|.:......|||.||.|..|.:.:.:.||...:...||...|.:.
Zfish    94 YSHEYSSKCSTCKKTVMPGSRKMEYKGNSWHETCFLCQRCQQPIGTKSFIPKDNNYFCVPCFEKQ 158

  Fly   120 FSSRCAGCEKPIDRRAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPICAAC 174
            |:.:|..|:|.|....|......||.:||.|..|:::::.:.|......|.|..|
Zfish   159 FAYQCCACKKAITTGGVTYHDKPWHRECFTCIGCKRQLAGQRFTSRENYPYCLDC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 19/68 (28%)
LIM 65..116 CDD:259829 15/52 (29%)
LIM 124..171 CDD:295319 13/46 (28%)
fhl5NP_001004112.1 LIM <6..34 CDD:295319 2/4 (50%)
LIM1_FHL 37..95 CDD:188729 15/57 (26%)
LIM 102..158 CDD:295319 16/55 (29%)
LIM3_FHL 163..214 CDD:188732 15/51 (29%)
LIM4_FHL 222..277 CDD:188733
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11189
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4575
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.