DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and fhl1a

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001007288.1 Gene:fhl1a / 399646 ZFINID:ZDB-GENE-040206-1 Length:297 Species:Danio rerio


Alignment Length:177 Identity:55/177 - (31%)
Similarity:81/177 - (45%) Gaps:9/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCRCNEKIWP--RAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSAC 68
            |..|.:.|.|  :.|....|.:|...|||.||...:..:.|....||:.|:.|:..|.|..|..|
Zfish   118 CQGCYKVITPGCKNVEYKHKVWHEECFTCFECKQPIRTQSFLTKGDDMYCTPCHEKKFAKHCVRC 182

  Fly    69 RTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPID- 132
            :..|...|:...::.||.:||.|.:|.|.|..|.|.......:|...::...:.:|:||:.||. 
Zfish   183 KEAITSGGLTYQDQPWHSECFVCHTCKKPLAGARFTAHEDQFYCVDCYKSDVAKKCSGCQNPITG 247

  Fly   133 ---RRAVVALSTK-WHAKCFKCHHCRKRISAREFWIENGQPI-CAAC 174
               ...||....| ||..||.|..|...::.:.|.| ||:.| |:.|
Zfish   248 FGRGTNVVNYEDKSWHEYCFNCKKCSLSMAHKRFVI-NGEDIYCSDC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 17/56 (30%)
LIM 65..116 CDD:259829 15/50 (30%)
LIM 124..171 CDD:295319 19/52 (37%)
fhl1aNP_001007288.1 LIM <21..49 CDD:295319
LIM1_FHL1 56..110 CDD:188730
LIM2_FHL1 118..175 CDD:188808 17/56 (30%)
LIM3_FHL1 179..231 CDD:188813 15/51 (29%)
LIM4_FHL1 234..297 CDD:188734 21/61 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11189
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4575
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.