DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and pxna

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_963882.1 Gene:pxna / 399546 ZFINID:ZDB-GENE-040105-1 Length:533 Species:Danio rerio


Alignment Length:169 Identity:62/169 - (36%)
Similarity:90/169 - (53%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCRCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSACRT 70
            |..|:..|..:.|.:|.||:||.||.|.:||....|:.|...:....|.:.|.|..|.:|..|..
Zfish   359 CYYCSGPILDKVVTALDKTWHPEHFFCAQCGSFFGPEGFHEKEGKAYCRKDYFDMFAPKCGGCAR 423

  Fly    71 PILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDRRA 135
            .|||..::|....||.:||.|..|....|:.||||..|..:|:||:.|...|.|:||:|||..|.
Zfish   424 AILENYISALNSLWHPECFVCRECFTPFVNGSFFEHEGQPYCEAHYHERRGSLCSGCQKPITGRC 488

  Fly   136 VVALSTKWHAKCFKCHHCRKRISAREFWIENGQPICAAC 174
            :.|:..|:|.:.|.|..|.|:::...|..:|.:|.|.:|
Zfish   489 ITAMGKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQSC 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 19/54 (35%)
LIM 65..116 CDD:259829 20/50 (40%)
LIM 124..171 CDD:295319 17/46 (37%)
pxnaNP_963882.1 Paxillin 54..229 CDD:281527
LIM1_Paxillin_like 300..352 CDD:259830
LIM2_Paxillin 359..410 CDD:188791 17/50 (34%)
LIM3_Paxillin 418..470 CDD:188793 21/51 (41%)
LIM4_Paxillin 477..528 CDD:188795 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583873
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.