DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and pdlim1

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_017950803.1 Gene:pdlim1 / 394527 XenbaseID:XB-GENE-1004691 Length:345 Species:Xenopus tropicalis


Alignment Length:58 Identity:19/58 - (32%)
Similarity:27/58 - (46%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHA 62
            ||..|...|....|....|.:||..:.|.:||:.:..|..|.|:|.:.|     :|||
 Frog   275 ICGHCGSGIVGVFVKIRDKPHHPECYVCTDCGMNLKQKGHFFVEDKMYC-----EKHA 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 15/54 (28%)
LIM 65..116 CDD:259829
LIM 124..171 CDD:295319
pdlim1XP_017950803.1 PDZ_signaling 5..81 CDD:238492
DUF4749 137..225 CDD:374237
LIM_CLP36 276..327 CDD:188832 16/55 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.