DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Tes

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster


Alignment Length:183 Identity:50/183 - (27%)
Similarity:72/183 - (39%) Gaps:16/183 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWPRAVC----SLGK--TYHPHHFTCKECGLVVDPKLFFAVDDDVVCS-ECYLDKHA 62
            :|..||:.|....|.    ..||  .:||..|.|..|..::...::|.....|.|. :..:....
  Fly   626 LCADCNQPIAMGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVYFFHQGQVFCGRDLAIRLKI 690

  Fly    63 ARCSACRTPILERGVAAAER-KWHEKCFRCVSCSKSLVSASFF--EVNGYLFCKAHFRELFSSRC 124
            .||.||...|..:...|||. .:|.|.|.|..|.:.|....:.  |.:....|...:..||:.||
  Fly   691 PRCRACDELIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCYDRLFAVRC 755

  Fly   125 AGCE---KPIDRRAVVALSTKWHAKCFKCH--HCRKRISAREFWIENGQPICA 172
            ..|:   .|.| :.|......|||.||.|.  .|.|.:....|.::...|.|:
  Fly   756 QRCKVAIGPAD-QGVAWGDVHWHASCFVCAGVQCSKPLIGGRFCVKENMPFCS 807

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 15/61 (25%)
LIM 65..116 CDD:259829 15/53 (28%)
LIM 124..171 CDD:295319 15/51 (29%)
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 15/56 (27%)
LIM2_Testin_like 691..748 CDD:188727 16/56 (29%)
LIM 755..810 CDD:295319 16/54 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
21.910

Return to query results.
Submit another query.