DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Zasp52

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster


Alignment Length:171 Identity:51/171 - (29%)
Similarity:85/171 - (49%) Gaps:4/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWPRAVCSLGKTYHPHHFTC--KECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSA 67
            :|..||.:|....:.:||:.:.|.||.|  ..|...:....|.....|:.|..|:....|..||.
  Fly  2019 LCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEKGDLYCEYCFEKYLAPTCSK 2083

  Fly    68 CRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPID 132
            |...|....:.|..:.:|.:||.|..|.|...:..||..:|..:|:|.:.|||:::|..|..|::
  Fly  2084 CAGKIKGDCLNAIGKHFHPECFTCGQCGKIFGNRPFFLEDGNAYCEADWNELFTTKCFACGFPVE 2148

  Fly   133 R--RAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPIC 171
            .  |.|.||:..:|::||.|..|::.:..:.|:.:.|:|.|
  Fly  2149 AGDRWVEALNHNYHSQCFNCTFCKQNLEGQSFYNKGGRPFC 2189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 15/56 (27%)
LIM 65..116 CDD:259829 16/50 (32%)
LIM 124..171 CDD:295319 15/48 (31%)
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492
DUF4749 150..>217 CDD:292558
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839 14/52 (27%)
LIM 2081..2132 CDD:259829 16/50 (32%)
LIM3_Enigma_like_1 2140..2193 CDD:188845 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.