DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Lims2

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_006254658.1 Gene:Lims2 / 361303 RGDID:1305273 Length:341 Species:Rattus norvegicus


Alignment Length:178 Identity:55/178 - (30%)
Similarity:83/178 - (46%) Gaps:6/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWPRAVCSLGKTYHPHHFTCKECG--LVVDPKLFFAVDDDVVCSECYLDKHAARCSA 67
            ||.||:..|..:.:......|||.||:|..||  |..|.:   .:..::.|..|:.......|.|
  Rat   139 ICQRCHLAIDEQPLMFKNDPYHPDHFSCSHCGKELTSDAR---ELKGELYCLPCHDKMGIPICGA 200

  Fly    68 CRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPID 132
            ||.||..|.|.|..::||.:.|.|..|.|..:....:|..|..:|:.|:.:||...|..|...|:
  Rat   201 CRRPIEGRVVNALGKQWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHYNQLFGDVCYNCSHVIE 265

  Fly   133 RRAVVALSTKWHAKCFKCHHCRKRISAREFWIE-NGQPICAACQTVVP 179
            ...|.|||..|...||.|..|..:::.:..::| :.:|:|..|....|
  Rat   266 GDVVSALSKAWCVNCFSCSACNMKLTLKNKFVEFDMKPVCKRCYERFP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 16/56 (29%)
LIM 65..116 CDD:259829 18/50 (36%)
LIM 124..171 CDD:295319 14/47 (30%)
Lims2XP_006254658.1 LIM1_PINCH 15..73 CDD:188717
LIM2_PINCH 76..127 CDD:188718
LIM3_PINCH 140..190 CDD:188719 15/52 (29%)
LIM4_PINCH 196..249 CDD:188720 18/52 (35%)
LIM5_PINCH 257..310 CDD:188721 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.