DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Pxn

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_038945530.1 Gene:Pxn / 360820 RGDID:1305759 Length:1125 Species:Rattus norvegicus


Alignment Length:169 Identity:62/169 - (36%)
Similarity:91/169 - (53%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCRCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSACRT 70
            |..||..|..:.|.:|.:|:||.||.|.:||....|:.|...|....|.:.|.|..|.:|..|..
  Rat   951 CYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCAR 1015

  Fly    71 PILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDRRA 135
            .|||..::|....||.:||.|..|....|:.||||.:|..:|:.|:.|...|.|:||:|||..|.
  Rat  1016 AILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRC 1080

  Fly   136 VVALSTKWHAKCFKCHHCRKRISAREFWIENGQPICAAC 174
            :.|::.|:|.:.|.|..|.|:::...|..:|.:|.|.:|
  Rat  1081 ITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQSC 1119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 20/54 (37%)
LIM 65..116 CDD:259829 19/50 (38%)
LIM 124..171 CDD:295319 17/46 (37%)
PxnXP_038945530.1 Paxillin 121..320 CDD:397550
LIM1_Paxillin_like 892..944 CDD:259830
LIM2_Paxillin 951..1002 CDD:188791 18/50 (36%)
LIM3_Paxillin_like 1010..1062 CDD:188724 20/51 (39%)
LIM4_Paxillin 1069..1120 CDD:188795 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.