DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Pax

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster


Alignment Length:182 Identity:57/182 - (31%)
Similarity:88/182 - (48%) Gaps:13/182 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCR-CNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSACR 69
            ||. |.:.|..:.:.:||||:||.||||..|...:..:.||..|....|...|.:..:.||:.|.
  Fly   347 CCNACEKPIVGQVITALGKTWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDYHNLFSPRCAYCN 411

  Fly    70 TPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDRR 134
            ..||::.|.|.::.||.:.|.|..|.:......|.|.:|..:|:..:.|:|:.:|.||.:.|...
  Fly   412 GAILDKCVTALDKTWHTEHFFCAQCGQQFGEEGFHERDGKPYCRNDYFEMFAPKCNGCNRAIMEN 476

  Fly   135 AVVALSTKWHAKCFKCHHCRKRISAREFWIENGQP------------ICAAC 174
            .:.||:::||..||.|..||:......|:...|.|            :||.|
  Fly   477 YISALNSQWHPDCFVCRDCRQPFQGGSFFDHEGLPYCETHYHAKRGSLCAGC 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 20/55 (36%)
LIM 65..116 CDD:259829 15/50 (30%)
LIM 124..171 CDD:295319 16/58 (28%)
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 18/51 (35%)
LIM2_Paxillin_like 407..458 CDD:188723 15/50 (30%)
LIM3_Paxillin_like 466..518 CDD:188724 16/51 (31%)
LIM4_Paxillin 525..576 CDD:188795 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453097
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 1 0.900 - - E1_KOG1703
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1093
SonicParanoid 1 1.000 - - X39
98.780

Return to query results.
Submit another query.