DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and CG34325

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001097003.1 Gene:CG34325 / 32656 FlyBaseID:FBgn0085354 Length:179 Species:Drosophila melanogaster


Alignment Length:172 Identity:74/172 - (43%)
Similarity:104/172 - (60%) Gaps:1/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SICCRCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSAC 68
            |||.:|||.|..|.:.:||||:||.||.||:|...:....|...|...|||.|::..::..|..|
  Fly     6 SICHKCNEVIQLRIITALGKTWHPEHFVCKDCQCPITEASFNINDGQPVCSACFVSNYSGICHGC 70

  Fly    69 RTPILERGVAAAERKWHEKCFRCVS-CSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPID 132
            :.|||||.:.|....|||:||.|.. |.:.|..:||:|.:|..:|:..|..:|::||..|:.||.
  Fly    71 KRPILERTIKAMGETWHEECFLCRGPCMQQLAGSSFYEHDGLPYCRTDFEHMFAARCGNCKAPIT 135

  Fly   133 RRAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPICAAC 174
            ..|:|||..|||.:||||..|:..|:|..|.:|:.||:|.||
  Fly   136 ENAIVALDAKWHRECFKCKKCKTPITASSFVVEDNQPLCKAC 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 23/54 (43%)
LIM 65..116 CDD:259829 21/51 (41%)
LIM 124..171 CDD:295319 22/46 (48%)
CG34325NP_001097003.1 LIM 8..59 CDD:295319 22/50 (44%)
LIM 67..119 CDD:295319 21/51 (41%)
LIM 127..175 CDD:295319 22/47 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449842
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 1 0.900 - - E1_KOG1703
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
98.800

Return to query results.
Submit another query.