DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Fhl4

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001013190.2 Gene:Fhl4 / 314678 RGDID:1308978 Length:280 Species:Rattus norvegicus


Alignment Length:189 Identity:53/189 - (28%)
Similarity:79/189 - (41%) Gaps:19/189 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRC-NEKIWPRAVCSL-------------GKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSE 55
            :|..| :::.:|:....|             |..:|...|.|..|..|:..|.||..|:...|..
  Rat    87 LCNNCVSQQAFPKCKGCLKDIKQGEQSVEYKGTIWHKDCFVCSNCKEVIGTKTFFPKDEGFYCVA 151

  Fly    56 CYLDKHAARCSACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELF 120
            ||.......|..|..||...||:..::.||.:||.||:|||.|....|..::..:||...::...
  Rat   152 CYDILFTKYCVKCNKPITSGGVSYQDQPWHSECFVCVNCSKELSEQRFTVMDDKIFCVDCYKNFI 216

  Fly   121 SSRCAGCEKPI-----DRRAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPICAAC 174
            :.:||||:.||     ....|...:..||..||.|..|...::.:.|.....|..|..|
  Rat   217 AKKCAGCKNPITGFGKGSNVVTHETNSWHDYCFNCKACSVNLANKHFVFHQEQIYCPDC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 17/68 (25%)
LIM 65..116 CDD:259829 19/50 (38%)
LIM 124..171 CDD:295319 15/51 (29%)
Fhl4NP_001013190.2 LIM 39..91 CDD:413332 1/3 (33%)
LIM 100..157 CDD:413332 14/56 (25%)
LIM 161..213 CDD:413332 19/51 (37%)
LIM 216..279 CDD:413332 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10711
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.