Sequence 1: | NP_726395.1 | Gene: | CG30178 / 246501 | FlyBaseID: | FBgn0050178 | Length: | 187 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101449.1 | Gene: | Fhl3 / 313582 | RGDID: | 1307180 | Length: | 288 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 53/206 - (25%) |
---|---|---|---|
Similarity: | 85/206 - (41%) | Gaps: | 37/206 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 CCRCNEKIWPR-----------------------AVCS--LG----------KTYHPHHFTCKEC 35
Fly 36 GLVVDPKLFFAVDDDVVCSECYLDKHAARCSACRTPIL--ERGVAAAERKWHEKCFRCVSCSKSL 98
Fly 99 VSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDRRAVVALSTKWHAKCFKCHHCRKRISAREFW 163
Fly 164 IENGQPICAAC 174 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30178 | NP_726395.1 | LIM | 6..61 | CDD:295319 | 18/89 (20%) |
LIM | 65..116 | CDD:259829 | 18/52 (35%) | ||
LIM | 124..171 | CDD:295319 | 12/46 (26%) | ||
Fhl3 | NP_001101449.1 | LIM | <5..33 | CDD:413332 | 5/25 (20%) |
LIM1_FHL3 | 36..94 | CDD:188807 | 12/57 (21%) | ||
LIM2_FHL3 | 98..155 | CDD:188811 | 18/56 (32%) | ||
LIM3_FHL | 162..213 | CDD:188732 | 15/51 (29%) | ||
LIM | 221..284 | CDD:413332 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 56 | 1.000 | Domainoid score | I10711 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 131 | 1.000 | Inparanoid score | I4531 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
7 | 6.920 |