DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Fhl3

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001101449.1 Gene:Fhl3 / 313582 RGDID:1307180 Length:288 Species:Rattus norvegicus


Alignment Length:206 Identity:53/206 - (25%)
Similarity:85/206 - (41%) Gaps:37/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCRCNEKIWPR-----------------------AVCS--LG----------KTYHPHHFTCKEC 35
            |.:|||.::.|                       |.|.  :|          :.:|...|.|..|
  Rat     7 CAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRC 71

  Fly    36 GLVVDPKLFFAVDDDVVCSECYLDKHAARCSACRTPIL--ERGVAAAERKWHEKCFRCVSCSKSL 98
            ...:..:.|...|.:::|:|||....:::||||...::  .|.:....:.|||.||.|..|.:.|
  Rat    72 QRSLADEPFTCQDSELLCNECYCTAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPL 136

  Fly    99 VSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDRRAVVALSTKWHAKCFKCHHCRKRISAREFW 163
            .|.||....|..:|...:...|:.|||.|.|.:.:..|......||.:|..|..|:..::.::|.
  Rat   137 GSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFT 201

  Fly   164 IENGQPICAAC 174
            ..:..|.|.||
  Rat   202 SRDDDPYCVAC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 18/89 (20%)
LIM 65..116 CDD:259829 18/52 (35%)
LIM 124..171 CDD:295319 12/46 (26%)
Fhl3NP_001101449.1 LIM <5..33 CDD:413332 5/25 (20%)
LIM1_FHL3 36..94 CDD:188807 12/57 (21%)
LIM2_FHL3 98..155 CDD:188811 18/56 (32%)
LIM3_FHL 162..213 CDD:188732 15/51 (29%)
LIM 221..284 CDD:413332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10711
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.