DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Pdlim2

DIOPT Version :10

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_063130209.1 Gene:Pdlim2 / 290354 RGDID:1359203 Length:386 Species:Rattus norvegicus


Alignment Length:58 Identity:17/58 - (29%)
Similarity:26/58 - (44%) Gaps:1/58 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CSACRTPILERGVAAAERKW-HEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFS 121
            |..|...|..:.|...|.:: |..|:.|..|..:|.....|.|...|:|:.|.|:.:|
  Rat   320 CEKCSVNISNQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWVGNELYCEKHARQRYS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:413332
LIM 65..116 CDD:259829 14/51 (27%)
LIM 124..171 CDD:413332
Pdlim2XP_063130209.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.