Sequence 1: | NP_726395.1 | Gene: | CG30178 / 246501 | FlyBaseID: | FBgn0050178 | Length: | 187 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006257733.1 | Gene: | Fhl1 / 25177 | RGDID: | 2615 | Length: | 339 | Species: | Rattus norvegicus |
Alignment Length: | 199 | Identity: | 49/199 - (24%) |
---|---|---|---|
Similarity: | 82/199 - (41%) | Gaps: | 16/199 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 ASICCRCNEKIWPRA--VCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARC 65
Fly 66 SACRTPIL--ERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCE 128
Fly 129 KPIDRRAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQ------------PICAACQTVVPSP 181
Fly 182 RNLS 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30178 | NP_726395.1 | LIM | 6..61 | CDD:295319 | 13/56 (23%) |
LIM | 65..116 | CDD:259829 | 14/52 (27%) | ||
LIM | 124..171 | CDD:295319 | 14/58 (24%) | ||
Fhl1 | XP_006257733.1 | LIM | <21..49 | CDD:351770 | |
LIM1_FHL1 | 56..109 | CDD:188730 | 12/52 (23%) | ||
LIM2_FHL1 | 117..174 | CDD:188808 | 14/56 (25%) | ||
LIM3_FHL1 | 178..230 | CDD:188813 | 14/51 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 56 | 1.000 | Domainoid score | I10711 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 131 | 1.000 | Inparanoid score | I4531 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.960 |