DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Fhl1

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_006257733.1 Gene:Fhl1 / 25177 RGDID:2615 Length:339 Species:Rattus norvegicus


Alignment Length:199 Identity:49/199 - (24%)
Similarity:82/199 - (41%) Gaps:16/199 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ASICCRCNEKIWPRA--VCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARC 65
            |:.|..|.:.|...|  |....:.:|...|.|.:|...:..:.|.:.|..::|::|...:.:.||
  Rat    53 ANTCVECRKPISADAKEVHYKNRYWHDTCFRCAKCLHPLASETFVSKDGKILCNKCATREDSPRC 117

  Fly    66 SACRTPIL--ERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCE 128
            ..|...|:  ::.|......||:.||.|.:|.:.:.:.|||......:|.......|:..|..|.
  Rat   118 KGCFKAIVAGDQNVEYKGTIWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVKCN 182

  Fly   129 KPIDRRAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQ------------PICAACQTVVPSP 181
            |.|....:......|||:||.|..|.|:::.:.|.....|            ..||.|:..:...
  Rat   183 KAITSGGITYQDQPWHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGK 247

  Fly   182 RNLS 185
            |.:|
  Rat   248 RTVS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 13/56 (23%)
LIM 65..116 CDD:259829 14/52 (27%)
LIM 124..171 CDD:295319 14/58 (24%)
Fhl1XP_006257733.1 LIM <21..49 CDD:351770
LIM1_FHL1 56..109 CDD:188730 12/52 (23%)
LIM2_FHL1 117..174 CDD:188808 14/56 (25%)
LIM3_FHL1 178..230 CDD:188813 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10711
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.