DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and FHL2

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001034581.1 Gene:FHL2 / 2274 HGNCID:3703 Length:279 Species:Homo sapiens


Alignment Length:178 Identity:55/178 - (30%)
Similarity:81/178 - (45%) Gaps:6/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ASICCRCNEKIWP--RAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARC 65
            :|.|..|.:.|.|  |.:...|.::|...|.|..|...:..|.|...|:...|..||..:||.:|
Human    98 SSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQC 162

  Fly    66 SACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKP 130
            ..|:.||...||...|:.||::||.|.:|.|.|....|...:.:.:|...|.:|::.:||||..|
Human   163 VQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNP 227

  Fly   131 ID----RRAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPICAAC 174
            |.    .:.:.....:||..||.|..|...:..|.|..|....:|..|
Human   228 ISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 16/56 (29%)
LIM 65..116 CDD:259829 17/50 (34%)
LIM 124..171 CDD:295319 15/50 (30%)
FHL2NP_001034581.1 LIM <5..33 CDD:413332
LIM1_FHL2 36..97 CDD:188806
LIM2_FHL2 101..157 CDD:188810 16/55 (29%)
LIM3_Fhl2 162..218 CDD:188815 19/55 (35%)
LIM4_FHL2 221..278 CDD:188817 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4662
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.