DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and FHL1

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_006724806.1 Gene:FHL1 / 2273 HGNCID:3702 Length:339 Species:Homo sapiens


Alignment Length:199 Identity:48/199 - (24%)
Similarity:82/199 - (41%) Gaps:16/199 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ASICCRCNEKIW--PRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARC 65
            |:.|..|.:.|.  .:.|....:.:|...|.|.:|...:..:.|.|.|:.::|::|...:.:.:|
Human    53 ANTCVECRKPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKC 117

  Fly    66 SACRTPIL--ERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCE 128
            ..|...|:  ::.|......||:.||.|.:|.:.:.:.|||......:|.......|:..|..|.
Human   118 KGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVKCN 182

  Fly   129 KPIDRRAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQ------------PICAACQTVVPSP 181
            |.|....:......|||.||.|..|.|:::.:.|.....|            ..||.|:..:...
Human   183 KAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGK 247

  Fly   182 RNLS 185
            |.:|
Human   248 RTVS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 13/56 (23%)
LIM 65..116 CDD:259829 14/52 (27%)
LIM 124..171 CDD:295319 14/58 (24%)
FHL1XP_006724806.1 LIM <21..49 CDD:413332
LIM1_FHL1 56..109 CDD:188730 12/52 (23%)
LIM2_FHL1 117..174 CDD:188808 14/56 (25%)
LIM3_FHL1 178..230 CDD:188813 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4662
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.