DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Pdlim2

DIOPT Version :10

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_666090.1 Gene:Pdlim2 / 213019 MGIID:2384850 Length:349 Species:Mus musculus


Alignment Length:58 Identity:17/58 - (29%)
Similarity:26/58 - (44%) Gaps:1/58 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CSACRTPILERGVAAAERKW-HEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFS 121
            |..|...|..:.|...|.:: |..|:.|..|..:|.....|.|...|:|:.|.|:.:|
Mouse   283 CEKCSVNISNQAVRIQEGRYRHPGCYTCADCGLNLKMRGHFWVGNELYCEKHARQRYS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:413332
LIM 65..116 CDD:259829 14/51 (27%)
LIM 124..171 CDD:413332
Pdlim2NP_666090.1 PDZ_PDLIM-like 4..82 CDD:467235
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..147
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..212
DUF4749 <198..252 CDD:464948
LIM_Mystique 283..335 CDD:188833 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.