DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and C34B2.4

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_492793.1 Gene:C34B2.4 / 183192 WormBaseID:WBGene00016389 Length:131 Species:Caenorhabditis elegans


Alignment Length:137 Identity:36/137 - (26%)
Similarity:54/137 - (39%) Gaps:18/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCRCNEKIWPR-AVCSLGKTYHPHHFTCKECGL-VVDPKLFFAVDDDVVCSECYLDKHAARCSAC 68
            |..|:.||... |:.:.||.:|.:|..|..|.. :.|.:.....:..::||||::......|..|
 Worm     4 CGHCSVKIGEESAILANGKVWHVNHLLCDLCKCRINDGERCVPQNGVILCSECHIKTTRPICKGC 68

  Fly    69 RTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRC--AGCEKPI 131
            ...|......|....||..||:|..|.|.|              |..|.:|.:..|  :.|...:
 Worm    69 GEFIKTNFCEALNSTWHPTCFQCSVCQKPL--------------KVDFHQLPNRMCVHSDCFWDL 119

  Fly   132 DRRAVVA 138
            ..|.:||
 Worm   120 QLRMIVA 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 16/56 (29%)
LIM 65..116 CDD:259829 13/50 (26%)
LIM 124..171 CDD:295319 5/17 (29%)
C34B2.4NP_492793.1 LIM 4..57 CDD:259829 15/52 (29%)
LIM 65..>97 CDD:295319 10/31 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161137
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.