DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and C26C6.6

DIOPT Version :10

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_492106.1 Gene:C26C6.6 / 182934 WormBaseID:WBGene00007740 Length:136 Species:Caenorhabditis elegans


Alignment Length:115 Identity:32/115 - (27%)
Similarity:50/115 - (43%) Gaps:9/115 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCRCNEKIWP------RAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVV---CSECYLDKH 61
            |..|..||..      :.|..|.:.:|..|..|..|.|.:....:|....|.:   |..|::..:
 Worm     8 CAGCKAKIAEEDVEKNKVVFFLNRMWHRDHIQCIFCKLQISDNRYFRSSIDPMKPSCYACHIQTN 72

  Fly    62 AARCSACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLF 111
            ...|:.|..|::|||:.|..|.:|..||||..|:|::.....|.....:|
 Worm    73 HPSCTGCSLPVIERGLVAFNRLFHIDCFRCAICNKTIPQRKGFYERDMMF 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:413332 15/63 (24%)
LIM 65..116 CDD:259829 17/47 (36%)
LIM 124..171 CDD:413332
C26C6.6NP_492106.1 LIM 8..65 CDD:413332 13/56 (23%)
LIM 76..128 CDD:413332 17/47 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.