DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and unc-97

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_508943.3 Gene:unc-97 / 180827 WormBaseID:WBGene00006826 Length:348 Species:Caenorhabditis elegans


Alignment Length:199 Identity:59/199 - (29%)
Similarity:88/199 - (44%) Gaps:26/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SICCRCNEKI----WPRAVCS--------------LGKTYHPHHFTCKECGLVVDPKLFFA---V 47
            ::|..|||:.    ..|.||.              .|.::||:||.||.|    :.:|..|   |
 Worm   127 ALCRECNEREKAAGHGRYVCHKCHAMIDDGQHIKFRGDSFHPYHFKCKRC----NNELTTASREV 187

  Fly    48 DDDVVCSECYLDKHAARCSACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFC 112
            :.::.|..|:.......|.||..||.||.:||..:.||.:.|.|..|.|..:....:|..|..:|
 Worm   188 NGELYCLRCHDTMGIPICGACHRPIEERVIAALGKHWHVEHFVCSVCEKPFLGHRHYERKGLPYC 252

  Fly   113 KAHFRELFSSRCAGCEKPIDRRAVVALSTKWHAKCFKCHHCRKRISAR-EFWIENGQPICAACQT 176
            :.||.:||.:.|..|..|.......||...|..|||.|..|.|::..: :|:..:.:|.|..|..
 Worm   253 EQHFHKLFGNLCFKCGDPCCGEVFQALQKTWCVKCFSCSFCDKKLDQKTKFYEFDMKPTCKRCYD 317

  Fly   177 VVPS 180
            ..|:
 Worm   318 RFPT 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 20/75 (27%)
LIM 65..116 CDD:259829 18/50 (36%)
LIM 124..171 CDD:295319 14/47 (30%)
unc-97NP_508943.3 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718 1/5 (20%)
LIM3_PINCH 146..197 CDD:188719 13/54 (24%)
LIM4_PINCH 203..256 CDD:188720 18/52 (35%)
LIM5_PINCH 264..317 CDD:188721 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.