Sequence 1: | NP_726395.1 | Gene: | CG30178 / 246501 | FlyBaseID: | FBgn0050178 | Length: | 187 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_508943.3 | Gene: | unc-97 / 180827 | WormBaseID: | WBGene00006826 | Length: | 348 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 59/199 - (29%) |
---|---|---|---|
Similarity: | 88/199 - (44%) | Gaps: | 26/199 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 SICCRCNEKI----WPRAVCS--------------LGKTYHPHHFTCKECGLVVDPKLFFA---V 47
Fly 48 DDDVVCSECYLDKHAARCSACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFC 112
Fly 113 KAHFRELFSSRCAGCEKPIDRRAVVALSTKWHAKCFKCHHCRKRISAR-EFWIENGQPICAACQT 176
Fly 177 VVPS 180 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30178 | NP_726395.1 | LIM | 6..61 | CDD:295319 | 20/75 (27%) |
LIM | 65..116 | CDD:259829 | 18/50 (36%) | ||
LIM | 124..171 | CDD:295319 | 14/47 (30%) | ||
unc-97 | NP_508943.3 | LIM1_PINCH | 21..79 | CDD:188717 | |
LIM2_PINCH | 82..133 | CDD:188718 | 1/5 (20%) | ||
LIM3_PINCH | 146..197 | CDD:188719 | 13/54 (24%) | ||
LIM4_PINCH | 203..256 | CDD:188720 | 18/52 (35%) | ||
LIM5_PINCH | 264..317 | CDD:188721 | 16/52 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1593918at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.920 |