DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and pxl-1

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001021185.2 Gene:pxl-1 / 175831 WormBaseID:WBGene00016197 Length:413 Species:Caenorhabditis elegans


Alignment Length:166 Identity:59/166 - (35%)
Similarity:86/166 - (51%) Gaps:0/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCRCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSACRT 70
            |..|.:.|..:.|.:|||.:||.|:||.|||..:..:.||..:....|.|.|.::.:.:|..|..
 Worm   176 CAACGKPIIGQVVIALGKMWHPEHYTCCECGAELGQRPFFERNGRAFCEEDYHNQFSPKCQGCHR 240

  Fly    71 PILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDRRA 135
            .|.:|.|:...:.:|.:||.|..|::......|.|.||..:||..|..||:.:|.||.:||....
 Worm   241 AITDRCVSVMNKNFHIECFTCAECNQPFGEDGFHEKNGQTYCKRDFFRLFAPKCNGCSQPITSNF 305

  Fly   136 VVALSTKWHAKCFKCHHCRKRISAREFWIENGQPIC 171
            :.||.|.||..||.|.||....:...|:..||.|:|
 Worm   306 ITALGTHWHPDCFVCQHCGVSFNGASFFEHNGAPLC 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 20/54 (37%)
LIM 65..116 CDD:259829 16/50 (32%)
LIM 124..171 CDD:295319 19/46 (41%)
pxl-1NP_001021185.2 LIM1_Leupaxin 174..228 CDD:188790 19/51 (37%)
LIM 235..290 CDD:278823 17/54 (31%)
LIM3_Paxillin_like 294..346 CDD:188724 20/48 (42%)
LIM4_Paxillin_like 353..404 CDD:188725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1093
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.