DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Y1A5A.1

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_497801.1 Gene:Y1A5A.1 / 175515 WormBaseID:WBGene00012379 Length:192 Species:Caenorhabditis elegans


Alignment Length:164 Identity:42/164 - (25%)
Similarity:73/164 - (44%) Gaps:38/164 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSACR 69
            :|..|::.|...|:.::.:.:||.||||..|...: .:.|.|.|:...|.:|:..|:..:|:.|.
 Worm    66 LCGHCHQSIGSEALVAMNRLWHPDHFTCSSCKRPI-KQTFQAADNHAYCVQCFAQKYNPKCAGCM 129

  Fly    70 TPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDRR 134
            ..:::..:.|.:|.||.:||.|.||::.|.:..|:.|:                    :||.|  
 Worm   130 ETLVDTCLLALDRHWHPRCFTCSSCNRPLPNGEFYLVD--------------------DKPYD-- 172

  Fly   135 AVVALSTKWHAKCFKCHHCRKRISAREFWIENGQ 168
                         ..||.. ||:..||. :|.|:
 Worm   173 -------------LDCHWA-KRLEKREH-MERGE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 16/54 (30%)
LIM 65..116 CDD:259829 14/50 (28%)
LIM 124..171 CDD:295319 11/45 (24%)
Y1A5A.1NP_497801.1 LIM 67..117 CDD:295319 15/50 (30%)
LIM_DA1 125..176 CDD:188782 17/85 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I3653
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29226
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.