DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and unc-95

DIOPT Version :10

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_740934.2 Gene:unc-95 / 173301 WormBaseID:WBGene00006824 Length:350 Species:Caenorhabditis elegans


Alignment Length:58 Identity:17/58 - (29%)
Similarity:28/58 - (48%) Gaps:7/58 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CAGCEKPIDRRAVVAL------STKWHAKCFKCHHCRKRISAREFWIENG-QPICAAC 174
            ||.|.:.||...:.||      :.|:|...|.|.:|:|.::....:.|:. :|.|..|
 Worm   270 CAYCSEEIDGAILTALAPNSERAQKFHTYHFMCTYCQKALNMHGTYREHDLKPYCHDC 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:413332
LIM 65..116 CDD:259829
LIM 124..171 CDD:413332 15/53 (28%)
unc-95NP_740934.2 LIM4_Paxillin_like 270..328 CDD:188725 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.