DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Lims1

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_006513131.1 Gene:Lims1 / 110829 MGIID:1195263 Length:398 Species:Mus musculus


Alignment Length:178 Identity:53/178 - (29%)
Similarity:85/178 - (47%) Gaps:6/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWPRAVCSLGKTYHPHHFTCKECG--LVVDPKLFFAVDDDVVCSECYLDKHAARCSA 67
            ||.:|:..|..:.:......|||.||.|..||  |..|.:   .:..::.|..|:.......|.|
Mouse   196 ICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADAR---ELKGELYCLPCHDKMGVPICGA 257

  Fly    68 CRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPID 132
            ||.||..|.|.|..::||.:.|.|..|.|..:....:|..|..:|:.|:.:||...|..|.:.|:
Mouse   258 CRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIE 322

  Fly   133 RRAVVALSTKWHAKCFKCHHCRKRISAREFWIE-NGQPICAACQTVVP 179
            ...|.||:..|...||.|..|..:::.::.::| :.:|:|..|...:|
Mouse   323 GDVVSALNKAWCVSCFACSTCNTKLTLKDKFVEIDLKPVCKYCYEKMP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 15/56 (27%)
LIM 65..116 CDD:259829 18/50 (36%)
LIM 124..171 CDD:295319 13/47 (28%)
Lims1XP_006513131.1 LIM1_PINCH 72..130 CDD:188717
LIM2_PINCH 133..184 CDD:188718
LIM3_PINCH 197..247 CDD:188719 14/52 (27%)
LIM4_PINCH 253..306 CDD:188720 18/52 (35%)
LIM5_PINCH 314..367 CDD:188721 15/52 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.