DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and PDLIM5

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001243355.2 Gene:PDLIM5 / 10611 HGNCID:17468 Length:625 Species:Homo sapiens


Alignment Length:176 Identity:53/176 - (30%)
Similarity:83/176 - (47%) Gaps:16/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWPRAVCSLGKTYHPHHFTCKEC-------GLVVDPKLFFAVDDDVVCSECYLDKHA 62
            :|..||:.|....:.:|||::||..|.|..|       |.|.:....:       |..||....|
Human   448 MCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALY-------CELCYEKFFA 505

  Fly    63 ARCSACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGC 127
            ..|..|:..||...::|.::.||..||.||:|.|.:.:..|...:|..:|:..:..||.:.|.||
Human   506 PECGRCQRKILGEVISALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHGC 570

  Fly   128 EKPIDR--RAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPIC 171
            |.||:.  ..:.||...||..||.|..|.:.:..:.|:.:..:|:|
Human   571 EFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLC 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 17/61 (28%)
LIM 65..116 CDD:259829 16/50 (32%)
LIM 124..171 CDD:295319 16/48 (33%)
PDLIM5NP_001243355.2 PDZ_signaling 10..82 CDD:238492
DUF4749 105..201 CDD:406377
LIM1_ENH 449..500 CDD:188837 15/57 (26%)
LIM 508..559 CDD:413332 16/50 (32%)
LIM3_ENH 567..621 CDD:188843 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.