DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and tgfb1i1

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_012825390.2 Gene:tgfb1i1 / 100038241 XenbaseID:XB-GENE-493249 Length:503 Species:Xenopus tropicalis


Alignment Length:169 Identity:58/169 - (34%)
Similarity:83/169 - (49%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCRCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSACRT 70
            |..|...|....|.:||.|:||.||.||.|...:..:.|...|.:..||:.|.....|.|:.|..
 Frog   329 CALCELPIVQNMVTALGCTWHPEHFCCKVCKKPIGEEGFHEKDGEQYCSDDYFRLFGAVCAGCSE 393

  Fly    71 PILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDRRA 135
            .:.|..::|....||.:||.|..|....::.||||..|...|:.|:.....|.|||||:||..|.
 Frog   394 AVKESYISALGGLWHPQCFVCHVCHTPFINGSFFEHEGLPLCETHYHSRRGSLCAGCEQPITGRC 458

  Fly   136 VVALSTKWHAKCFKCHHCRKRISAREFWIENGQPICAAC 174
            |.|:..|:|.:...|..|.::::...|...:|:|.|.||
 Frog   459 VTAMGKKFHPQHLNCTFCLRQLNKGTFREHDGKPYCQAC 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 19/54 (35%)
LIM 65..116 CDD:259829 16/50 (32%)
LIM 124..171 CDD:295319 17/46 (37%)
tgfb1i1XP_012825390.2 Paxillin <61..>117 CDD:397550
LIM1_Paxillin_like 270..322 CDD:259830
LIM2_Paxillin_like 329..380 CDD:188723 18/50 (36%)
LIM3_Paxillin_like 388..440 CDD:188724 17/51 (33%)
LIM4_Paxillin_like 447..498 CDD:188725 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1093
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.