DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and synpo2lb

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_001341280.3 Gene:synpo2lb / 100001241 ZFINID:ZDB-GENE-090828-5 Length:1184 Species:Danio rerio


Alignment Length:67 Identity:16/67 - (23%)
Similarity:28/67 - (41%) Gaps:9/67 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VDDDVVCSECYLDKHAARCSACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLF 111
            ||:::..:  |:||       .|...|.||.:..:::..|...:|.:.:..|..|......|.|.
Zfish   308 VDEELTVT--YMDK-------ARQAKLHRGESLQDKQVKEARSKCRTIASLLTDAPNPHSKGVLM 363

  Fly   112 CK 113
            .|
Zfish   364 FK 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 4/13 (31%)
LIM 65..116 CDD:259829 11/49 (22%)
LIM 124..171 CDD:295319
synpo2lbXP_001341280.3 PDZ_signaling 5..84 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.