DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and HVA22F

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_181810.2 Gene:HVA22F / 818882 AraportID:AT2G42820 Length:158 Species:Arabidopsis thaliana


Alignment Length:104 Identity:26/104 - (25%)
Similarity:43/104 - (41%) Gaps:15/104 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLPGWSSLRAIGHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLSFYAGLKLILSVGLWFSAP 76
            |.|.::|.|||........:.||.||:||:|:....:....:|..|.|:..|||:..  :|...|
plant    22 LYPLYASFRAIESPTMLDDQQWLTYWIIYSLITIFELSVWRVLAWLPFWPYLKLLFC--MWLVLP 84

  Fly    77 YSTNHLFNLLNTYSMGKLCPVVEKGVRWHEKVCRNIFRG 115
            ..:...:             :....||.:.|:..|:..|
plant    85 MFSGAAY-------------IYSNFVRQYVKIGMNVGGG 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 18/58 (31%)
HVA22FNP_181810.2 TB2_DP1_HVA22 24..100 CDD:460820 22/90 (24%)

Return to query results.
Submit another query.