DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and REEP4

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_079508.2 Gene:REEP4 / 80346 HGNCID:26176 Length:257 Species:Homo sapiens


Alignment Length:77 Identity:23/77 - (29%)
Similarity:44/77 - (57%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLVYIYYGTLLPGWSSLRAI-GHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLSFYAGLKLI 66
            |||.:.:|.|.|.::|.:|: ..:.|.::. |:.||:::||.....::||..:....||..:|  
Human     8 RLVVLVFGMLCPAYASYKAVKTKNIREYVR-WMMYWIVFALFMAAEIVTDIFISWFPFYYEIK-- 69

  Fly    67 LSVGLWFSAPYS 78
            ::..||..:||:
Human    70 MAFVLWLLSPYT 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 15/59 (25%)
REEP4NP_079508.2 TB2_DP1_HVA22 19..94 CDD:460820 18/66 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..257
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.