DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and REEP5

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_005660.4 Gene:REEP5 / 7905 HGNCID:30077 Length:189 Species:Homo sapiens


Alignment Length:87 Identity:27/87 - (31%)
Similarity:37/87 - (42%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRLVYIYYGTLL--------PGWSSLRAIGHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLS 58
            |.||:.|..:||        |.:.|::||....:.....||.|||:|.:.......:|..|....
Human    47 LYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFP 111

  Fly    59 FYAGLKLILSVGLWFSAPYSTN 80
            ||..||  ....||..||..:|
Human   112 FYYMLK--CGFLLWCMAPSPSN 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 17/58 (29%)
REEP5NP_005660.4 TB2_DP1_HVA22 67..144 CDD:460820 21/67 (31%)
Required for dimerization and maintaining endoplasmic reticulum morphology. /evidence=ECO:0000269|PubMed:32075961 114..185 7/20 (35%)

Return to query results.
Submit another query.