DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and Reep4

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_006519661.1 Gene:Reep4 / 72549 MGIID:1919799 Length:293 Species:Mus musculus


Alignment Length:113 Identity:22/113 - (19%)
Similarity:41/113 - (36%) Gaps:40/113 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLVYIYYGTLLPGWSSLRAI-GHDQRHFIELWLKYWVIYALLQGLGVLTDFLLG----------- 55
            |||.:.:|.|.|.::|.:|: ..:.|.::. |:.||:::|:.......||..:.           
Mouse     8 RLVVLIFGMLYPAYASYKAVKSKNIREYVR-WMMYWIVFAIFMAAETFTDIFISWSGPRIGRPWG 71

  Fly    56 -------------------------GLSFYAGLKLILSVGLWFSAPYS 78
                                     ...||...|  ::..||..:||:
Mouse    72 WEGPHHHHHHHLASGSHKPLPLLTHRFPFYYEFK--MAFVLWLLSPYT 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 14/95 (15%)
Reep4XP_006519661.1 TB2_DP1_HVA22 19..130 CDD:460820 17/102 (17%)
PRK11675 <247..>279 CDD:183272
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.