DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and reep4

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001016224.1 Gene:reep4 / 548978 XenbaseID:XB-GENE-982259 Length:261 Species:Xenopus tropicalis


Alignment Length:77 Identity:22/77 - (28%)
Similarity:41/77 - (53%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLVYIYYGTLLPGWSSLRAI-GHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLSFYAGLKLI 66
            |.|.:.:|.|.|.::|.:|: ..:.|.::. |:.||:::||...:...||..:....||..:|:.
 Frog     8 RAVVLVFGLLYPAYASYKAVKTKNVREYVR-WMMYWIVFALFMTVETFTDIFIAWFPFYYEIKMA 71

  Fly    67 LSVGLWFSAPYS 78
            ..|  |..:||:
 Frog    72 FVV--WLLSPYT 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 15/59 (25%)
reep4NP_001016224.1 TB2_DP1_HVA22 19..94 CDD:460820 18/66 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..261
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.