DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and zgc:101744

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001013554.2 Gene:zgc:101744 / 541409 ZFINID:ZDB-GENE-050320-111 Length:184 Species:Danio rerio


Alignment Length:86 Identity:29/86 - (33%)
Similarity:40/86 - (46%) Gaps:12/86 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVYIYYGTLL--------PGWSSLRAIGHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLSF- 59
            |::.|..:||        |.::|::||..:.:.....||.|||:|.|.......:|..|....| 
Zfish    49 LIFGYGASLLCNLIGFIYPAYASIKAIESNNKEDDTKWLTYWVVYGLFSVAEFFSDIFLFWFPFY 113

  Fly    60 YAGLKLILSVGLWFSAPYSTN 80
            |||..|.|   ||..||.|.|
Zfish   114 YAGKCLFL---LWCMAPISWN 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 20/59 (34%)
zgc:101744NP_001013554.2 TB2_DP1_HVA22 67..144 CDD:460820 25/68 (37%)

Return to query results.
Submit another query.