DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and Reep1

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_030111355.1 Gene:Reep1 / 52250 MGIID:1098827 Length:284 Species:Mus musculus


Alignment Length:77 Identity:26/77 - (33%)
Similarity:41/77 - (53%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLVYIYYGTLLPGWSSLRAI-GHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLSFYAGLKLI 66
            |||.:.:|||.|.:.|.:|: ..|.:.::: |:.||:|:||.......||..|....||..||:.
Mouse     8 RLVVLIFGTLYPAYYSYKAVKSKDIKEYVK-WMMYWIIFALFTTAETFTDIFLCWFPFYYELKIA 71

  Fly    67 LSVGLWFSAPYS 78
            ...  |..:||:
Mouse    72 FVA--WLLSPYT 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 17/59 (29%)
Reep1XP_030111355.1 TB2_DP1_HVA22 19..94 CDD:460820 20/66 (30%)

Return to query results.
Submit another query.