DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and CG4960

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_651429.1 Gene:CG4960 / 43115 FlyBaseID:FBgn0039371 Length:174 Species:Drosophila melanogaster


Alignment Length:71 Identity:18/71 - (25%)
Similarity:26/71 - (36%) Gaps:2/71 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GTLLPGWSSLRAIGHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLSFYAGLKLILSVGLWFS 74
            |.|.|.:.|:..|....:.....||.|||.:.:...:......|...:.||..||....:  |..
  Fly    74 GVLYPAYISIHGIESSTKQDDIRWLIYWVTFGIFTVIEFYPSLLTSMIPFYWLLKCTFLI--WCM 136

  Fly    75 APYSTN 80
            .|...|
  Fly   137 LPTERN 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 13/58 (22%)
CG4960NP_651429.1 TB2_DP1_HVA22 78..155 CDD:460820 16/67 (24%)

Return to query results.
Submit another query.