DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30177 and Reep6

DIOPT Version :10

Sequence 1:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001013236.1 Gene:Reep6 / 362835 RGDID:1309508 Length:211 Species:Rattus norvegicus


Alignment Length:87 Identity:27/87 - (31%)
Similarity:41/87 - (47%) Gaps:13/87 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRLVYIYYGTLL--------PGWSSLRAIGHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLS 58
            |.|::.|..:||        |.::|::||....:....:||.|||:|||...:...:|.||....
  Rat    46 LYLLFGYGASLLCNVIGFVYPAYASVKAIESPNKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFP 110

  Fly    59 FY-----AGLKLILSVGLWFSA 75
            ||     |.|...::.|.|..|
  Rat   111 FYYAGKCAFLLFCMTPGPWNGA 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30177NP_726366.1 TB2_DP1_HVA22 14..>73 CDD:460820 20/63 (32%)
Reep6NP_001013236.1 TB2_DP1_HVA22 66..143 CDD:460820 22/67 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..211
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.